LRRC8B anticorps (N-Term)

N° du produit ABIN635448

Détail du produit anti-LRRC8B anticorps

Antigène: LRRC8B (Leucine Rich Repeat Containing 8 Family, Member B (LRRC8B))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC8B est non-conjugé

Application: Western Blotting (WB)

Specificité: LRRC8 B antibody was raised against the N terminal of LRRC8

Purification: Affinity purified

Immunogène: LRRC8 B antibody was raised using the N terminal of LRRC8 corresponding to a region with amino acids PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC8B Blocking Peptide, catalog no. 33R-7375, is also available for use as a blocking control in assays to test for specificity of this LRRC8B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC8B

Antigène: LRRC8B (Leucine Rich Repeat Containing 8 Family, Member B (LRRC8B))

Autre désignation: LRRC8B (LRRC8B Produits)

Synonymes: anticorps TA-LRRP, anticorps TALRRP, anticorps R75581, anticorps Ta-lrrp, anticorps mKIAA0231, anticorps RGD1563429, anticorps leucine rich repeat containing 8 family member B, anticorps leucine rich repeat containing 8 VRAC subunit B S homeolog, anticorps leucine rich repeat containing 8 VRAC subunit B, anticorps leucine rich repeat containing 8 family, member B, anticorps LRRC8B, anticorps lrrc8b.S, anticorps lrrc8b, anticorps Lrrc8b

Sujet: The function of LRRC8B protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 92 kDa (MW of target protein)