C19orf56 anticorps (N-Term)

N° du produit ABIN635449

Détail du produit anti-C19orf56 anticorps

Antigène: C19orf56 (Chromosome 19 Open Reading Frame 56 (C19orf56))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C19orf56 est non-conjugé

Application: Western Blotting (WB)

Specificité: C19 ORF56 antibody was raised against the N terminal Of C19 rf56

Purification: Affinity purified

Immunogène: C19 ORF56 antibody was raised using the N terminal Of C19 rf56 corresponding to a region with amino acids STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C19ORF56 Blocking Peptide, catalog no. 33R-8878, is also available for use as a blocking control in assays to test for specificity of this C19ORF56 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF56 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C19orf56

Antigène: C19orf56 (Chromosome 19 Open Reading Frame 56 (C19orf56))

Autre désignation: C19ORF56 (C19orf56 Produits)

Synonymes: anticorps MGC81480, anticorps C19orf56, anticorps PTD008, anticorps C7H19orf56, anticorps WD repeat domain 83 opposite strand L homeolog, anticorps WD repeat domain 83 opposite strand, anticorps wdr83os.L, anticorps WDR83OS, anticorps wdr83os

Sujet: The function of C19orf56 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 12 kDa (MW of target protein)