TMEM69 anticorps (Middle Region)

N° du produit ABIN635451

Détail du produit anti-TMEM69 anticorps

Antigène: TMEM69 (Transmembrane Protein 69 (TMEM69))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM69 est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Specificité: TMEM69 antibody was raised against the middle region of TMEM69

Purification: Affinity purified

Immunogène: TMEM69 antibody was raised using the middle region of TMEM69 corresponding to a region with amino acids AYGASFLSFLGGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLISE

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM69 Blocking Peptide, catalog no. 33R-1628, is also available for use as a blocking control in assays to test for specificity of this TMEM69 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM69 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM69

Antigène: TMEM69 (Transmembrane Protein 69 (TMEM69))

Autre désignation: TMEM69 (TMEM69 Produits)

Synonymes: anticorps zgc:194288, anticorps zgc:194295, anticorps C1orf154, anticorps RP11-767N6.4, anticorps A630048M13Rik, anticorps Transmembrane protein 69, anticorps transmembrane protein 69, anticorps tmm69, anticorps TMEM69, anticorps tmem69, anticorps Tmem69

Sujet: The function of TMEM69 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 27 kDa (MW of target protein)