TMEM161A anticorps (Middle Region)

N° du produit ABIN635452

Détail du produit anti-TMEM161A anticorps

Antigène: TMEM161A (Transmembrane Protein 161A (TMEM161A))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM161A est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM161 A antibody was raised against the middle region of TMEM161

Purification: Affinity purified

Immunogène: TMEM161 A antibody was raised using the middle region of TMEM161 corresponding to a region with amino acids LLAMLVQVVREETLELGLEPGLASMTQNLEPLLKKQGWDWALPVAKLAIR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM161A Blocking Peptide, catalog no. 33R-5117, is also available for use as a blocking control in assays to test for specificity of this TMEM161A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM160 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM161A

Antigène: TMEM161A (Transmembrane Protein 161A (TMEM161A))

Autre désignation: TMEM161A (TMEM161A Produits)

Synonymes: anticorps AROS-29, anticorps AI428876, anticorps BB161850, anticorps BC021367, anticorps RGD1307703, anticorps transmembrane protein 161A, anticorps transmembrane protein 161A L homeolog, anticorps TMEM161A, anticorps Tmem161a, anticorps tmem161a.L

Sujet: TMEM161A may be involved in the development of dendritic cells.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: Positive Regulation of Response to DNA Damage Stimulus