RHBDL2 anticorps
-
- Antigène Voir toutes RHBDL2 Anticorps
- RHBDL2 (Rhomboid, Veinlet-Like 2 (RHBDL2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RHBDL2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- RHBDL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWIT
- Top Product
- Discover our top product RHBDL2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RHBDL2 Blocking Peptide, catalog no. 33R-4732, is also available for use as a blocking control in assays to test for specificity of this RHBDL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHBDL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RHBDL2 (Rhomboid, Veinlet-Like 2 (RHBDL2))
- Autre désignation
- RHBDL2 (RHBDL2 Produits)
- Synonymes
- anticorps RRP2, anticorps 9130416B15, anticorps rhomboid like 2, anticorps rhomboid, veinlet-like 2 (Drosophila), anticorps RHBDL2, anticorps Rhbdl2
- Sujet
- RHBDL2 is a member of the rhomboid family of integral membrane proteins. This family contains proteins that are related to Drosophila rhomboid protein. Members of this family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases. RHBDL2 is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3.
- Poids moléculaire
- 34 kDa (MW of target protein)
-