TMEM127 anticorps (Middle Region)
-
- Antigène Voir toutes TMEM127 Anticorps
- TMEM127 (Transmembrane Protein 127 (TMEM127))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMEM127 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TMEM127 antibody was raised against the middle region of TMEM127
- Purification
- Affinity purified
- Immunogène
- TMEM127 antibody was raised using the middle region of TMEM127 corresponding to a region with amino acids AFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQ
- Top Product
- Discover our top product TMEM127 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMEM127 Blocking Peptide, catalog no. 33R-1166, is also available for use as a blocking control in assays to test for specificity of this TMEM127 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM127 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMEM127 (Transmembrane Protein 127 (TMEM127))
- Autre désignation
- TMEM127 (TMEM127 Produits)
- Synonymes
- anticorps zgc:109899, anticorps 2310003P10Rik, anticorps AI314202, anticorps AI317350, anticorps RGD1309744, anticorps transmembrane protein 127, anticorps transmembrane protein 127 S homeolog, anticorps tmem127, anticorps TMEM127, anticorps tmem127.S, anticorps Tmem127
- Sujet
- TMEM127 is a multi-pass membrane protein. The exact function of TMEM127 remains unknown.
- Poids moléculaire
- 26 kDa (MW of target protein)
-