TMEM127 anticorps (Middle Region)

N° du produit ABIN635454

Détail du produit anti-TMEM127 anticorps

Antigène: TMEM127 (Transmembrane Protein 127 (TMEM127))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM127 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM127 antibody was raised against the middle region of TMEM127

Purification: Affinity purified

Immunogène: TMEM127 antibody was raised using the middle region of TMEM127 corresponding to a region with amino acids AFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM127 Blocking Peptide, catalog no. 33R-1166, is also available for use as a blocking control in assays to test for specificity of this TMEM127 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM127 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM127

Antigène: TMEM127 (Transmembrane Protein 127 (TMEM127))

Autre désignation: TMEM127 (TMEM127 Produits)

Synonymes: anticorps zgc:109899, anticorps 2310003P10Rik, anticorps AI314202, anticorps AI317350, anticorps RGD1309744, anticorps transmembrane protein 127, anticorps transmembrane protein 127 S homeolog, anticorps tmem127, anticorps TMEM127, anticorps tmem127.S, anticorps Tmem127

Sujet: TMEM127 is a multi-pass membrane protein. The exact function of TMEM127 remains unknown.

Poids moléculaire: 26 kDa (MW of target protein)