FAM70A anticorps (N-Term)

N° du produit ABIN635455

Détail du produit anti-FAM70A anticorps

Antigène: FAM70A (Family with Sequence Similarity 70, Member A (FAM70A))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM70A est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM70 A antibody was raised against the N terminal of FAM70

Purification: Affinity purified

Immunogène: FAM70 A antibody was raised using the N terminal of FAM70 corresponding to a region with amino acids IVDGVFAARHIDLKPLYANRCHYVPKTSQKEAEEVISSSTKNSPSTRVMR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM70A Blocking Peptide, catalog no. 33R-4195, is also available for use as a blocking control in assays to test for specificity of this FAM70A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM70A

Antigène: FAM70A (Family with Sequence Similarity 70, Member A (FAM70A))

Autre désignation: FAM70A (FAM70A Produits)

Synonymes: anticorps FAM70A, anticorps 4933417N17, anticorps 6430550H21Rik, anticorps Fam70a, anticorps RGD727788, anticorps fam70a, anticorps transmembrane protein 255A, anticorps transmembrane protein 255A L homeolog, anticorps TMEM255A, anticorps Tmem255a, anticorps tmem255a.L, anticorps tmem255a

Sujet: The function of FAM70A protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 38 kDa (MW of target protein)