HLC8 anticorps (N-Term)

N° du produit ABIN635456

Détail du produit anti-HLC8 anticorps

Antigène: HLC8 (C17orf80) (Chromosome 17 Open Reading Frame 80 (C17orf80))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HLC8 est non-conjugé

Application: Western Blotting (WB)

Specificité: C17 ORF80 antibody was raised against the N terminal Of C17 rf80

Purification: Affinity purified

Immunogène: C17 ORF80 antibody was raised using the N terminal Of C17 rf80 corresponding to a region with amino acids MSDNPPRMEVCPYCKKPFKRLKSHLPYCKMIGPTIPTDQKVYQSKPATLP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C17ORF80 Blocking Peptide, catalog no. 33R-6409, is also available for use as a blocking control in assays to test for specificity of this C17ORF80 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HLC8

Antigène: HLC8 (C17orf80) (Chromosome 17 Open Reading Frame 80 (C17orf80))

Autre désignation: C17ORF80 (C17orf80 Produits)

Synonymes: anticorps HLC-8, anticorps MIG3, anticorps SPEP1, anticorps mig3, anticorps hlc-8, anticorps chromosome 17 open reading frame 80, anticorps chromosome 18 open reading frame, human C17orf80, anticorps chromosome 17 open reading frame, human C17orf80, anticorps DNA segment, Chr 11, Wayne State University 47, expressed, anticorps C17orf80, anticorps C17ORF80, anticorps C17H17orf80, anticorps c17orf80, anticorps D11Wsu47e

Sujet: The function of C17orf80 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 67 kDa (MW of target protein)