SUSD4 anticorps (Middle Region)

N° du produit ABIN635458

Détail du produit anti-SUSD4 anticorps

Antigène: SUSD4 (Sushi Domain Containing 4 (SUSD4))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SUSD4 est non-conjugé

Application: Western Blotting (WB)

Specificité: SUSD4 antibody was raised against the middle region of SUSD4

Purification: Affinity purified

Immunogène: SUSD4 antibody was raised using the middle region of SUSD4 corresponding to a region with amino acids HGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SUSD4 Blocking Peptide, catalog no. 33R-3734, is also available for use as a blocking control in assays to test for specificity of this SUSD4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUSD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SUSD4

Antigène: SUSD4 (Sushi Domain Containing 4 (SUSD4))

Autre désignation: SUSD4 (SUSD4 Produits)

Synonymes: anticorps susd4, anticorps MGC146481, anticorps DKFZp469E106, anticorps PRO222, anticorps AI848994, anticorps E430021N18Rik, anticorps N28096, anticorps RGD1564043, anticorps sushi domain containing 4, anticorps toll-like receptor 5, anticorps SUSD4, anticorps tlr5, anticorps Susd4

Sujet: SUSD4 contains 4 Sushi (CCP/SCR) domains. It is a single-pass type I membrane protein. The function of the SUSD4 protein remains unknown.

Poids moléculaire: 54 kDa (MW of target protein)