LRRC59 anticorps (C-Term)

N° du produit ABIN635464

Détail du produit anti-LRRC59 anticorps

Antigène: LRRC59 (Leucine Rich Repeat Containing 59 (LRRC59))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC59 est non-conjugé

Application: Western Blotting (WB)

Specificité: LRRC59 antibody was raised against the C terminal of LRRC59

Purification: Affinity purified

Immunogène: LRRC59 antibody was raised using the C terminal of LRRC59 corresponding to a region with amino acids KEYDALKAAKREQEKKPKKEANQAPKSKSGSRPRKPPPRKHTRSWAVLKL

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC59 Blocking Peptide, catalog no. 33R-4365, is also available for use as a blocking control in assays to test for specificity of this LRRC59 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC59 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC59

Antigène: LRRC59 (Leucine Rich Repeat Containing 59 (LRRC59))

Autre désignation: LRRC59 (LRRC59 Produits)

Synonymes: anticorps p34, anticorps PRO1855, anticorps AA959742, anticorps C78668, anticorps leucine rich repeat containing 59, anticorps leucine rich repeat containing 59 S homeolog, anticorps LRRC59, anticorps Lrrc59, anticorps lrrc59.S

Sujet: The function of LRRC59 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 35 kDa (MW of target protein)