TMCO1 anticorps (C-Term)

N° du produit ABIN635466

Détail du produit anti-TMCO1 anticorps

Antigène: TMCO1 (Transmembrane and Coiled-Coil Domains 1 (TMCO1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMCO1 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMCO1 antibody was raised against the C terminal of TMCO1

Purification: Affinity purified

Immunogène: TMCO1 antibody was raised using the C terminal of TMCO1 corresponding to a region with amino acids CSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMCO1 Blocking Peptide, catalog no. 33R-1807, is also available for use as a blocking control in assays to test for specificity of this TMCO1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMCO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMCO1

Antigène: TMCO1 (Transmembrane and Coiled-Coil Domains 1 (TMCO1))

Autre désignation: TMCO1 (TMCO1 Produits)

Synonymes: anticorps DKFZp459A2226, anticorps sb:cb729, anticorps zgc:110322, anticorps zgc:92740, anticorps HP10122, anticorps PCIA3, anticorps PNAS-136, anticorps RP11-466F5.7, anticorps TMCC4, anticorps 1190006A08Rik, anticorps 4930403O06Rik, anticorps AA109065, anticorps AU022572, anticorps ESTM39, anticorps transmembrane and coiled-coil domains 1, anticorps transmembrane and coiled-coil domains 1 S homeolog, anticorps TMCO1, anticorps tmco1, anticorps tmco1.S, anticorps Tmco1

Sujet: TMCO1 belongs to the TMCO1 family. The exact function of TMCO1 remains unknown.

Poids moléculaire: 21 kDa (MW of target protein)