DOLPP1 anticorps (N-Term)

N° du produit ABIN635468

Détail du produit anti-DOLPP1 anticorps

Antigène: DOLPP1 (Dolichyl Pyrophosphate Phosphatase 1 (DOLPP1))

Épitope: N-Term

Reactivité: Souris, Rat, Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DOLPP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: DOLPP1 antibody was raised against the N terminal of DOLPP1

Purification: Affinity purified

Immunogène: DOLPP1 antibody was raised using the N terminal of DOLPP1 corresponding to a region with amino acids AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DOLPP1 Blocking Peptide, catalog no. 33R-1013, is also available for use as a blocking control in assays to test for specificity of this DOLPP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DOLPP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DOLPP1

Antigène: DOLPP1 (Dolichyl Pyrophosphate Phosphatase 1 (DOLPP1))

Autre désignation: DOLPP1 (DOLPP1 Produits)

Synonymes: anticorps zgc:101585, anticorps lsfr2, anticorps DOLPP1, anticorps 0610011H20Rik, anticorps AB030189, anticorps LSFR2, anticorps dolichyldiphosphatase 1, anticorps dolichyl pyrophosphate phosphatase 1, anticorps dolichyldiphosphatase 1 L homeolog, anticorps DOLPP1, anticorps dolpp1, anticorps Dolpp1, anticorps dolpp1.L

Sujet: DOLPP1 is a multi-pass membrane proteinBy similarity. It belongs to the dolichyldiphosphatase family. It is required for efficient N-glycosylation and is necessary for maintaining optimal levels of dolichol-linked oligosaccharides. DOLPP1 hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. It does not act on phosphatidate.

Poids moléculaire: 27 kDa (MW of target protein)