APMAP anticorps (N-Term)

N° du produit ABIN635470

Détail du produit anti-APMAP anticorps

Antigène: APMAP (Adipocyte Plasma Membrane Associated Protein (APMAP))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APMAP est non-conjugé

Application: Western Blotting (WB)

Specificité: C20 ORF3 antibody was raised against the N terminal Of C20 rf3

Purification: Affinity purified

Immunogène: C20 ORF3 antibody was raised using the N terminal Of C20 rf3 corresponding to a region with amino acids EPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C20ORF3 Blocking Peptide, catalog no. 33R-2640, is also available for use as a blocking control in assays to test for specificity of this C20ORF3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur APMAP

Antigène: APMAP (Adipocyte Plasma Membrane Associated Protein (APMAP))

Autre désignation: C20ORF3 (APMAP Produits)

Synonymes: anticorps BSCv, anticorps C20orf3, anticorps C13H20orf3, anticorps 2310001A20Rik, anticorps AI314817, anticorps RGD1308874, anticorps bscv, anticorps cb351, anticorps wu:fb50a03, anticorps zgc:55833, anticorps zgc:85628, anticorps APMAP, anticorps adipocyte plasma membrane associated protein, anticorps APMAP, anticorps Apmap, anticorps apmap

Sujet: C20orf3 exhibits strong arylesterase activity with beta-naphthyl acetate and phenyl acetate. It may play a role in adipocyte differentiation.

Poids moléculaire: 46 kDa (MW of target protein)