FAM62B anticorps

N° du produit ABIN635474

Détail du produit anti-FAM62B anticorps

Antigène: FAM62B (ESYT2) (Extended Synaptotagmin 2 (ESYT2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM62B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: FAM62 B antibody was raised using a synthetic peptide corresponding to a region with amino acids NSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM62B Blocking Peptide, catalog no. 33R-6875, is also available for use as a blocking control in assays to test for specificity of this FAM62B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM62B

Antigène: FAM62B (ESYT2) (Extended Synaptotagmin 2 (ESYT2))

Autre désignation: FAM62B (ESYT2 Produits)

Synonymes: anticorps CHR2SYT, anticorps E-Syt2, anticorps FAM62B, anticorps 2410017M09Rik, anticorps 4921504I16Rik, anticorps D12Ertd551e, anticorps Fam62b, anticorps extended synaptotagmin 2, anticorps extended synaptotagmin-like protein 2, anticorps ESYT2, anticorps Esyt2

Sujet: FAM62B may play a role as calcium-regulated intrinsic membrane protein.

Poids moléculaire: 99 kDa (MW of target protein)