BAT5 anticorps (N-Term)

N° du produit ABIN635476

Détail du produit anti-BAT5 anticorps

Antigène: BAT5 (ABHD16A) (Abhydrolase Domain Containing 16A (ABHD16A))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BAT5 est non-conjugé

Application: Western Blotting (WB)

Specificité: BAT5 antibody was raised against the N terminal of BAT5

Purification: Affinity purified

Immunogène: BAT5 antibody was raised using the N terminal of BAT5 corresponding to a region with amino acids VTAPHSSSWDTYYQPRALEKHADSILALASVFWSISYYSSPFAFFYLYRK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BAT5 Blocking Peptide, catalog no. 33R-9837, is also available for use as a blocking control in assays to test for specificity of this BAT5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BAT5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BAT5

Antigène: BAT5 (ABHD16A) (Abhydrolase Domain Containing 16A (ABHD16A))

Autre désignation: BAT5 (ABHD16A Produits)

Synonymes: anticorps BAT5, anticorps D6S82E, anticorps NG26, anticorps PP199, anticorps AI326074, anticorps Bat-5, anticorps Bat5, anticorps D17H6S82E, anticorps bat5, anticorps bat5l, anticorps wu:fb55e01, anticorps bat5-b, anticorps ng26, anticorps pp199, anticorps abhydrolase domain containing 16A, anticorps abhydrolase domain containing 16A L homeolog, anticorps ABHD16A, anticorps Abhd16a, anticorps abhd16a, anticorps abhd16a.L

Sujet: A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. BAT5 is thought to be involved in some aspects of immunity.

Poids moléculaire: 63 kDa (MW of target protein)