TNMD anticorps (N-Term)

N° du produit ABIN635478

Détail du produit anti-TNMD anticorps

Antigène: TNMD (Tenomodulin (TNMD))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TNMD est non-conjugé

Application: Western Blotting (WB)

Specificité: Tenomodulin antibody was raised against the N terminal of TNMD

Purification: Affinity purified

Immunogène: Tenomodulin antibody was raised using the N terminal of TNMD corresponding to a region with amino acids KKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tenomodulin Blocking Peptide, catalog no. 33R-4477, is also available for use as a blocking control in assays to test for specificity of this Tenomodulin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNMD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TNMD

Antigène: TNMD (Tenomodulin (TNMD))

Autre désignation: Tenomodulin (TNMD Produits)

Synonymes: anticorps zgc:172161, anticorps TeM, anticorps BRICD4, anticorps CHM1L, anticorps TEM, anticorps 1110017I01Rik, anticorps Bricd4, anticorps ChM1L, anticorps tenomodulin, anticorps TNMD, anticorps tnmd, anticorps Tnmd

Sujet: TNMD is a single-pass type II membrane proteinPotential. It belongs to the chondromodulin-1 family and contains 1 BRICHOS domain. TNMD may be an angiogenesis inhibitor.

Poids moléculaire: 37 kDa (MW of target protein)