TMEM38A anticorps (N-Term)

N° du produit ABIN635479

Détail du produit anti-TMEM38A anticorps

Antigène: TMEM38A (Transmembrane Protein 38A (TMEM38A))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM38A est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM38 A antibody was raised against the N terminal of TMEM38

Purification: Affinity purified

Immunogène: TMEM38 A antibody was raised using the N terminal of TMEM38 corresponding to a region with amino acids GEPLIDYFSNNSSILLASAVWYLIFFCPLDLFYKCVCFLPVKLIFVAMKE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM38A Blocking Peptide, catalog no. 33R-3241, is also available for use as a blocking control in assays to test for specificity of this TMEM38A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM38A

Antigène: TMEM38A (Transmembrane Protein 38A (TMEM38A))

Autre désignation: TMEM38A (TMEM38A Produits)

Synonymes: anticorps zgc:77831, anticorps MGC75707, anticorps TMEM38A, anticorps TRIC-A, anticorps TRICA, anticorps 1110001E17Rik, anticorps AI413399, anticorps mg33a, anticorps RGD1307901, anticorps Srp-27, anticorps transmembrane protein 38A, anticorps transmembrane protein 38a, anticorps transmembrane protein 38A L homeolog, anticorps tmem38a, anticorps CpipJ_CPIJ011791, anticorps CpipJ_CPIJ013655, anticorps TMEM38A, anticorps Tmem38a, anticorps tmem38a.L

Sujet: TMEM38A is a monovalent cation channel required for maintenance of rapid intracellular calcium release. It may act as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores.

Poids moléculaire: 33 kDa (MW of target protein)