PRRG3 anticorps (N-Term)

N° du produit ABIN635480

Détail du produit anti-PRRG3 anticorps

Antigène: PRRG3 (Proline Rich Gla (G-Carboxyglutamic Acid) 3 (Transmembrane) (PRRG3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRRG3 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRRG3 antibody was raised against the N terminal of PRRG3

Purification: Affinity purified

Immunogène: PRRG3 antibody was raised using the N terminal of PRRG3 corresponding to a region with amino acids EEICSYEEVKEVFENKEKTMEFWKGYPNAVYSVRDPSQSSDAMYVVVPLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRRG3 Blocking Peptide, catalog no. 33R-2360, is also available for use as a blocking control in assays to test for specificity of this PRRG3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRRG3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRRG3

Antigène: PRRG3 (Proline Rich Gla (G-Carboxyglutamic Acid) 3 (Transmembrane) (PRRG3))

Autre désignation: PRRG3 (PRRG3 Produits)

Synonymes: anticorps MGC84023, anticorps PRGP3, anticorps TMG3, anticorps Gm368, anticorps RGD1560309, anticorps proline rich and Gla domain 3, anticorps proline rich Gla (G-carboxyglutamic acid) 3 (transmembrane) L homeolog, anticorps proline rich Gla (G-carboxyglutamic acid) 3 (transmembrane), anticorps PRRG3, anticorps prrg3.L, anticorps Prrg3

Sujet: The function of PRRG3 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 26 kDa (MW of target protein)