FAM134A anticorps (N-Term)

N° du produit ABIN635481

Détail du produit anti-FAM134A anticorps

Antigène: FAM134A (Family with Sequence Similarity 134, Member A (FAM134A))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM134A est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM134 A antibody was raised against the N terminal of FAM134

Purification: Affinity purified

Immunogène: FAM134 A antibody was raised using the N terminal of FAM134 corresponding to a region with amino acids AGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQFCVRVCS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM134A Blocking Peptide, catalog no. 33R-1221, is also available for use as a blocking control in assays to test for specificity of this FAM134A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM130 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM134A

Antigène: FAM134A (Family with Sequence Similarity 134, Member A (FAM134A))

Autre désignation: FAM134A (FAM134A Produits)

Synonymes: anticorps C2orf17, anticorps RGD1306844, anticorps reticulophagy regulator family member 2, anticorps RETREG2, anticorps Retreg2

Sujet: The function of FAM134 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 58 kDa (MW of target protein)