STEAP4 anticorps (C-Term)

N° du produit ABIN635483

Détail du produit anti-STEAP4 anticorps

Antigène: STEAP4 (STEAP Family Member 4 (STEAP4))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STEAP4 est non-conjugé

Application: Western Blotting (WB)

Specificité: STEAP4 antibody was raised against the C terminal of STEAP4

Purification: Affinity purified

Immunogène: STEAP4 antibody was raised using the C terminal of STEAP4 corresponding to a region with amino acids AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STEAP4 Blocking Peptide, catalog no. 33R-1165, is also available for use as a blocking control in assays to test for specificity of this STEAP4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STEAP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STEAP4

Antigène: STEAP4 (STEAP Family Member 4 (STEAP4))

Autre désignation: STEAP4 (STEAP4 Produits)

Synonymes: anticorps STAMP2, anticorps TIARP, anticorps TNFAIP9, anticorps MGC68826, anticorps STEAP4, anticorps MGC108044, anticorps steap4, anticorps 1110021O17Rik, anticorps AI481214, anticorps Tiarp, anticorps Tnfaip9, anticorps si:dkey-53p21.1, anticorps zgc:112143, anticorps STEAP4 metalloreductase, anticorps STEAP4 metalloreductase L homeolog, anticorps metalloreductase STEAP4, anticorps STEAP family member 4, anticorps STEAP4, anticorps steap4.L, anticorps Steap4, anticorps steap4, anticorps LOC100136336, anticorps LOC100353852

Sujet: Metalloreductase has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). It uses NAD(+) as acceptor.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis