FTHL17 anticorps (N-Term)

N° du produit ABIN635486

Détail du produit anti-FTHL17 anticorps

Antigène: FTHL17 (Ferritin, Heavy Polypeptide-Like 17 (FTHL17))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FTHL17 est non-conjugé

Application: Western Blotting (WB)

Specificité: FTHL17 antibody was raised against the N terminal of FTHL17

Purification: Affinity purified

Immunogène: FTHL17 antibody was raised using the N terminal of FTHL17 corresponding to a region with amino acids MAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRLQNLRGGHICLHDIR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FTHL17 Blocking Peptide, catalog no. 33R-5656, is also available for use as a blocking control in assays to test for specificity of this FTHL17 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTHL17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FTHL17

Antigène: FTHL17 (Ferritin, Heavy Polypeptide-Like 17 (FTHL17))

Autre désignation: FTHL17 (FTHL17 Produits)

Synonymes: anticorps CT38, anticorps ferritin heavy chain like 17, anticorps ferritin, heavy polypeptide-like 17, member E, anticorps FTHL17, anticorps Fthl17e

Sujet: This gene is similar to a mouse gene that encodes a ferritin heavy polypeptide-like protein.

Poids moléculaire: 21 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis