ESYT3 anticorps

N° du produit ABIN635487

Détail du produit anti-ESYT3 anticorps

Antigène: ESYT3 (Extended Synaptotagmin-Like Protein 3 (ESYT3))

Reactivité: Rat, Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ESYT3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: FAM62 C antibody was raised using a synthetic peptide corresponding to a region with amino acids RNRRGKLGRLAAAFEFLDNEREFISRELRGQHLPAWIHFPDVERVEWANK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM62C Blocking Peptide, catalog no. 33R-8085, is also available for use as a blocking control in assays to test for specificity of this FAM62C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ESYT3

Antigène: ESYT3 (Extended Synaptotagmin-Like Protein 3 (ESYT3))

Autre désignation: FAM62C (ESYT3 Produits)

Synonymes: anticorps Fam62c, anticorps RGD1561304, anticorps fam62a, anticorps fam62c, anticorps FAM62A, anticorps im:7153182, anticorps si:ch211-219a4.7, anticorps FAM62C, anticorps DKFZp459I013, anticorps CHR3SYT, anticorps E-Syt3, anticorps D930024E11, anticorps D9Ertd280e, anticorps mKIAA4186, anticorps extended synaptotagmin 3, anticorps extended synaptotagmin protein 3, anticorps extended synaptotagmin-like protein 3, anticorps extended synaptotagmin-3, anticorps Esyt3, anticorps ESYT3, anticorps esyt3, anticorps LOC100468549, anticorps LOC100594943

Sujet: FAM62C belongs to the extended synaptotagmin family. It is a single-pass membrane protein, and contains 3 C2 domains. FAM62C may play a role as calcium-regulated intrinsic membrane protein.

Poids moléculaire: 100 kDa (MW of target protein)