ESYT3 anticorps
-
- Antigène Voir toutes ESYT3 Anticorps
- ESYT3 (Extended Synaptotagmin-Like Protein 3 (ESYT3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ESYT3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- FAM62 C antibody was raised using a synthetic peptide corresponding to a region with amino acids EVFEFMVYEVPGQDLEVDLYDEDTDRDDFLGSLQICLGDVMTNRVVDEWF
- Top Product
- Discover our top product ESYT3 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FAM62C Blocking Peptide, catalog no. 33R-2783, is also available for use as a blocking control in assays to test for specificity of this FAM62C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM60 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ESYT3 (Extended Synaptotagmin-Like Protein 3 (ESYT3))
- Autre désignation
- FAM62C (ESYT3 Produits)
- Synonymes
- anticorps Fam62c, anticorps RGD1561304, anticorps fam62a, anticorps fam62c, anticorps FAM62A, anticorps im:7153182, anticorps si:ch211-219a4.7, anticorps FAM62C, anticorps DKFZp459I013, anticorps CHR3SYT, anticorps E-Syt3, anticorps D930024E11, anticorps D9Ertd280e, anticorps mKIAA4186, anticorps extended synaptotagmin 3, anticorps extended synaptotagmin protein 3, anticorps extended synaptotagmin-like protein 3, anticorps extended synaptotagmin-3, anticorps Esyt3, anticorps ESYT3, anticorps esyt3, anticorps LOC100468549, anticorps LOC100594943
- Sujet
- FAM62C belongs to the extended synaptotagmin family. It is a single-pass membrane protein, and contains 3 C2 domains. FAM62C may play a role as calcium-regulated intrinsic membrane protein.
- Poids moléculaire
- 100 kDa (MW of target protein)
-