TSPAN10 anticorps (N-Term)

N° du produit ABIN635489

Détail du produit anti-TSPAN10 anticorps

Antigène: TSPAN10 (Tetraspanin 10 (TSPAN10))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TSPAN10 est non-conjugé

Application: Western Blotting (WB)

Specificité: Tetraspanin 10 antibody was raised against the N terminal of TSPAN10

Purification: Affinity purified

Immunogène: Tetraspanin 10 antibody was raised using the N terminal of TSPAN10 corresponding to a region with amino acids SCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPADPMLG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tetraspanin 10 Blocking Peptide, catalog no. 33R-8345, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TSPAN10

Antigène: TSPAN10 (Tetraspanin 10 (TSPAN10))

Autre désignation: Tetraspanin 10 (TSPAN10 Produits)

Synonymes: anticorps GB13074, anticorps OCSP, anticorps Ocsp, anticorps tetraspanin 10, anticorps tetraspanin-10, anticorps Tspan10, anticorps TSPAN10, anticorps LOC483364

Sujet: TSPAN10 belongs to the tetraspanin (TM4SF) family. It is a multi-pass membrane protein. The exact function of TSPAN10 remains unknown.

Poids moléculaire: 37 kDa (MW of target protein)