RNFT2 anticorps (N-Term)

N° du produit ABIN635491

Détail du produit anti-RNFT2 anticorps

Antigène: RNFT2 (Ring Finger Protein, Transmembrane 2 (RNFT2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNFT2 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM118 antibody was raised against the N terminal Of Tmem118

Purification: Affinity purified

Immunogène: TMEM118 antibody was raised using the N terminal Of Tmem118 corresponding to a region with amino acids HGGHRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM118 Blocking Peptide, catalog no. 33R-3736, is also available for use as a blocking control in assays to test for specificity of this TMEM118 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM118 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNFT2

Antigène: RNFT2 (Ring Finger Protein, Transmembrane 2 (RNFT2))

Autre désignation: TMEM118 (RNFT2 Produits)

Synonymes: anticorps TMEM118, anticorps AW049082, anticorps B830028P19Rik, anticorps Tmem118, anticorps RGD1560195, anticorps RNFT2, anticorps si:dkey-175n1.1, anticorps zgc:109947, anticorps ring finger protein, transmembrane 2, anticorps RNFT2, anticorps Rnft2, anticorps rnft2

Sujet: TMEM118 is a multi-pass membrane protein, and contains 1 RING-type zinc finger. The function of TMEM118 remains unknown.

Poids moléculaire: 46 kDa (MW of target protein)