ORAI2 anticorps (Middle Region)
-
- Antigène Voir toutes ORAI2 Anticorps
- ORAI2 (ORAI Calcium Release-Activated Calcium Modulator 2 (ORAI2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ORAI2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ORAI2 antibody was raised against the middle region of ORAI2
- Purification
- Affinity purified
- Immunogène
- ORAI2 antibody was raised using the middle region of ORAI2 corresponding to a region with amino acids IELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARRQPGPPPGPGSHTGWQ
- Top Product
- Discover our top product ORAI2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ORAI2 Blocking Peptide, catalog no. 33R-3944, is also available for use as a blocking control in assays to test for specificity of this ORAI2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ORAI2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ORAI2 (ORAI Calcium Release-Activated Calcium Modulator 2 (ORAI2))
- Autre désignation
- ORAI2 (ORAI2 Produits)
- Synonymes
- anticorps C7orf19, anticorps CBCIP2, anticorps MEM142B, anticorps TMEM142B, anticorps A730041O15Rik, anticorps Tmem142b, anticorps RGD1310213, anticorps ORAI2, anticorps orai-1, anticorps orai1, anticorps tmem142a, anticorps tmem142b, anticorps LOC100230993, anticorps ORAI calcium release-activated calcium modulator 2, anticorps ORAI calcium release-activated calcium modulator 2 S homeolog, anticorps ORAI2, anticorps Orai2, anticorps orai2.S, anticorps orai2
- Sujet
- ORAI2 is a multi-pass membrane protein, and it belongs to the Orai family. It is a Ca(2+) release-activated Ca(2+)-like (CRAC-like) channel subunit which mediates Ca(2+) influx and increase in Ca(2+)-selective current by synergy with the Ca(2+) sensor, STIM1.
- Poids moléculaire
- 28 kDa (MW of target protein)
-