Claudin 18 anticorps (Middle Region)

N° du produit ABIN635504

Détail du produit anti-Claudin 18 anticorps

Antigène: Claudin 18 (CLDN18)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Claudin 18 est non-conjugé

Application: Western Blotting (WB)

Specificité: Claudin 18 antibody was raised against the middle region of CLDN18

Purification: Affinity purified

Immunogène: Claudin 18 antibody was raised using the middle region of CLDN18 corresponding to a region with amino acids LVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Claudin 18 Blocking Peptide, catalog no. 33R-5545, is also available for use as a blocking control in assays to test for specificity of this Claudin 18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Claudin 18

Antigène: Claudin 18 (CLDN18)

Autre désignation: Claudin 18 (CLDN18 Produits)

Synonymes: anticorps claudin-18, anticorps CLDN18, anticorps SFTA5, anticorps SFTPJ, anticorps claudin 18 L homeolog, anticorps claudin 18, anticorps cldn18.L, anticorps CLDN18, anticorps Cldn18

Sujet: CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C