HEPACAM anticorps (N-Term)

N° du produit ABIN635516

Détail du produit anti-HEPACAM anticorps

Antigène: HEPACAM (Hepatic and Glial Cell Adhesion Molecule (HEPACAM))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HEPACAM est non-conjugé

Application: Western Blotting (WB)

Specificité: HEPACAM antibody was raised against the N terminal of HEPACAM

Purification: Affinity purified

Immunogène: HEPACAM antibody was raised using the N terminal of HEPACAM corresponding to a region with amino acids LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HEPACAM Blocking Peptide, catalog no. 33R-5163, is also available for use as a blocking control in assays to test for specificity of this HEPACAM antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEPACAM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HEPACAM

Antigène: HEPACAM (Hepatic and Glial Cell Adhesion Molecule (HEPACAM))

Autre désignation: HEPACAM (HEPACAM Produits)

Synonymes: anticorps GlialCAM, anticorps MLC2A, anticorps MLC2B, anticorps 2900042E01Rik, anticorps Hepn1, anticorps hepatic and glial cell adhesion molecule, anticorps hepatocyte cell adhesion molecule, anticorps HEPACAM, anticorps Hepacam

Sujet: HEPACAM is involved in regulating cell motility and cell-matrix interactions. HEPACAM may inhibit cell growth through suppression of cell proliferation.

Poids moléculaire: 46 kDa (MW of target protein)