ABHD13 anticorps (N-Term)
-
- Antigène Voir toutes ABHD13 Anticorps
- ABHD13 (Abhydrolase Domain Containing 13 (ABHD13))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ABHD13 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ABHD13 antibody was raised against the N terminal of ABHD13
- Purification
- Affinity purified
- Immunogène
- ABHD13 antibody was raised using the N terminal of ABHD13 corresponding to a region with amino acids SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN
- Top Product
- Discover our top product ABHD13 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ABHD13 Blocking Peptide, catalog no. 33R-8762, is also available for use as a blocking control in assays to test for specificity of this ABHD13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ABHD13 (Abhydrolase Domain Containing 13 (ABHD13))
- Autre désignation
- ABHD13 (ABHD13 Produits)
- Synonymes
- anticorps BEM46L1, anticorps C13orf6, anticorps RP11-153I24.2, anticorps bA153I24.2, anticorps 1110065L07Rik, anticorps AI463703, anticorps AI788994, anticorps RGD1308317, anticorps zgc:123286, anticorps abhydrolase domain containing 13, anticorps abhydrolase domain containing 13 S homeolog, anticorps ABHD13, anticorps abhd13, anticorps abhd13.S, anticorps Abhd13
- Sujet
- ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown.
- Poids moléculaire
- 38 kDa (MW of target protein)
-