UNC5A anticorps
-
- Antigène Voir toutes UNC5A Anticorps
- UNC5A (Unc-5 Homolog A (UNC5A))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UNC5A est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- UNC5 A antibody was raised using a synthetic peptide corresponding to a region with amino acids VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT
- Top Product
- Discover our top product UNC5A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UNC5A Blocking Peptide, catalog no. 33R-9915, is also available for use as a blocking control in assays to test for specificity of this UNC5A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UNC5A (Unc-5 Homolog A (UNC5A))
- Autre désignation
- UNC5A (UNC5A Produits)
- Synonymes
- anticorps zgc:175190, anticorps UNC5H1, anticorps Unc5h1, anticorps mKIAA1976, anticorps unc-5 netrin receptor A, anticorps netrin receptor UNC5A, anticorps UNC5A, anticorps Tsp_02512, anticorps Tsp_13881, anticorps unc5a, anticorps Unc5a
- Sujet
- UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons.UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons.
- Poids moléculaire
- 93 kDa (MW of target protein)
-