ORCTL-2/SLC22A18 anticorps (Middle Region)
-
- Antigène Voir toutes ORCTL-2/SLC22A18 (SLC22A18) Anticorps
- ORCTL-2/SLC22A18 (SLC22A18) (Solute Carrier Family 22 Member 18 (SLC22A18))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ORCTL-2/SLC22A18 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC22 A18 antibody was raised against the middle region of SLC22 18
- Purification
- Affinity purified
- Immunogène
- SLC22 A18 antibody was raised using the middle region of SLC22 18 corresponding to a region with amino acids IQCPAILAALATLLGAVLSFTCIPASTKGAKTDAQAPLPGGPRASVFDLK
- Top Product
- Discover our top product SLC22A18 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC22A18 Blocking Peptide, catalog no. 33R-4110, is also available for use as a blocking control in assays to test for specificity of this SLC22A18 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 18 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ORCTL-2/SLC22A18 (SLC22A18) (Solute Carrier Family 22 Member 18 (SLC22A18))
- Autre désignation
- SLC22A18 (SLC22A18 Produits)
- Synonymes
- anticorps MGC123168, anticorps zgc:123168, anticorps BWR1A, anticorps BWSCR1A, anticorps HET, anticorps IMPT1, anticorps ITM, anticorps ORCTL2, anticorps SLC22A1L, anticorps TSSC5, anticorps p45-BWR1A, anticorps AW260131, anticorps Impt1, anticorps Orctl2, anticorps Slc22a1l, anticorps solute carrier family 22, member 18, anticorps solute carrier family 22 member 18, anticorps solute carrier family 22 (organic cation transporter), member 18, anticorps slc22a18, anticorps SLC22A18, anticorps Slc22a18
- Sujet
- This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer.
- Poids moléculaire
- 45 kDa (MW of target protein)
-