SAYSD1 anticorps (C-Term)
-
- Antigène Tous les produits SAYSD1
- SAYSD1 (SAYSVFN Motif Domain Containing 1 (SAYSD1))
-
Épitope
- C-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SAYSD1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C6 ORF64 antibody was raised against the C terminal Of C6 rf64
- Purification
- Affinity purified
- Immunogène
- C6 ORF64 antibody was raised using the C terminal Of C6 rf64 corresponding to a region with amino acids MYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGR
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C6ORF64 Blocking Peptide, catalog no. 33R-6632, is also available for use as a blocking control in assays to test for specificity of this C6ORF64 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF64 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SAYSD1 (SAYSVFN Motif Domain Containing 1 (SAYSD1))
- Autre désignation
- C6ORF64 (SAYSD1 Produits)
- Synonymes
- anticorps C6orf64, anticorps SAYSD1, anticorps C23H6orf64, anticorps 1810063B07Rik, anticorps 4930488P03Rik, anticorps SAYSVFN motif domain containing 1, anticorps SAYSD1, anticorps Saysd1
- Sujet
- The function of C6orf64 protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 20 kDa (MW of target protein)
-