Reticulon 1 anticorps (N-Term)

N° du produit ABIN635538

Détail du produit anti-Reticulon 1 anticorps

Antigène: Reticulon 1 (RTN1)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Reticulon 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: RTN1 antibody was raised against the N terminal of RTN1

Purification: Affinity purified

Immunogène: RTN1 antibody was raised using the N terminal of RTN1 corresponding to a region with amino acids EEREAELDSELIIESCDASSASEESPKREQDSPPMKPSALDAIREETGVR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RTN1 Blocking Peptide, catalog no. 33R-2384, is also available for use as a blocking control in assays to test for specificity of this RTN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Reticulon 1

Antigène: Reticulon 1 (RTN1)

Autre désignation: RTN1 (RTN1 Produits)

Synonymes: anticorps NSP, anticorps 0710005K15Rik, anticorps 4930441F12Rik, anticorps Nsp, anticorps R75279, anticorps Rtn1-a, anticorps Rtn1-b, anticorps Rtn1-c, anticorps reticulon-1, anticorps RTN1, anticorps RTN1-Cw, anticorps rtn1, anticorps XRTN1-A, anticorps XRTN1-C.1, anticorps xrtn1, anticorps xrtn1-c, anticorps RTN1.2, anticorps Rtn1-C.2, anticorps rtn1-a, anticorps rtn1b, anticorps xRTN1, anticorps RTN1.1, anticorps rtn1a, anticorps xrtn1-c.1, anticorps rtn1l, anticorps wu:fa21b09, anticorps wu:fj35h01, anticorps reticulon 1, anticorps reticulon-1, anticorps reticulon 1 S homeolog, anticorps reticulon 1 L homeolog, anticorps reticulon 1b, anticorps RTN1, anticorps Rtn1, anticorps rtn1, anticorps Rtnl1, anticorps LOC100580843, anticorps rtn1.S, anticorps rtn1.L, anticorps LOC100339591, anticorps rtn1b

Sujet: Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.

Poids moléculaire: 39 kDa (MW of target protein)