OCA2 anticorps (Middle Region)

N° du produit ABIN635550

Détail du produit anti-OCA2 anticorps

Antigène: OCA2 (P Protein (OCA2))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OCA2 est non-conjugé

Application: Western Blotting (WB)

Specificité: OCA2 antibody was raised against the middle region of OCA2

Purification: Affinity purified

Immunogène: OCA2 antibody was raised using the middle region of OCA2 corresponding to a region with amino acids LIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGIC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OCA2 Blocking Peptide, catalog no. 33R-5036, is also available for use as a blocking control in assays to test for specificity of this OCA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-OCA2 (ABIN635550)

Jeffery: "Distal Regeneration Involves the Age Dependent Activity of Branchial Sac Stem Cells in the Ascidian Ciona intestinalis." dans: Regeneration (Oxford, England), Vol. 2, Issue 1, pp. 1-18, (2015) (PubMed).

Détails sur OCA2

Antigène: OCA2 (P Protein (OCA2))

Autre désignation: OCA2 (OCA2 Produits)

Synonymes: anticorps D7H15S12, anticorps D7Icr28RN, anticorps D7Nic1, anticorps p, anticorps BEY, anticorps BEY1, anticorps BEY2, anticorps BOCA, anticorps D15S12, anticorps EYCL, anticorps EYCL2, anticorps EYCL3, anticorps HCL3, anticorps P, anticorps PED, anticorps SHEP1, anticorps OCA2, anticorps P protein, anticorps oculocutaneous albinism II, anticorps OCA2 melanosomal transmembrane protein, anticorps P, anticorps p, anticorps Oca2, anticorps OCA2, anticorps oca2

Classe de substances: Viral Protein

Sujet: This gene encodes the human homologue of the mouse p (pink-eyed dilution) gene. The encoded protein is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine - a precursor of melanin. Mutations in this gene result in type 2 oculocutaneous albinism.

Poids moléculaire: 93 kDa (MW of target protein)