SC5DL anticorps

N° du produit ABIN635551

Détail du produit anti-SC5DL anticorps

Antigène: SC5DL (Sterol-C5-Desaturase (SC5DL))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SC5DL est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SC5 DL antibody was raised using a synthetic peptide corresponding to a region with amino acids NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SC5DL Blocking Peptide, catalog no. 33R-6850, is also available for use as a blocking control in assays to test for specificity of this SC5DL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SC0 L antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SC5DL

Antigène: SC5DL (Sterol-C5-Desaturase (SC5DL))

Autre désignation: SC5DL (SC5DL Produits)

Synonymes: anticorps A830037K02, anticorps A830073K23Rik, anticorps Sc5dl, anticorps ERG3, anticorps S5DES, anticorps SC5DL, anticorps sc5d, anticorps sc5dl, anticorps sterol-C5-desaturase, anticorps sterol-C5-desaturase L homeolog, anticorps Sc5d, anticorps SC5D, anticorps sc5d.L

Sujet: This gene encodes an enzyme of cholesterol biosynthesis. The encoded protein catalyzes the conversion of lathosterol into 7-dehydrocholesterol. Mutations in this gene have been associated with lathosterolosis. Alternatively spliced transcript variants encoding the same protein have been described.

Poids moléculaire: 35 kDa (MW of target protein)