ABCC1 anticorps

N° du produit ABIN635554

Détail du produit anti-ABCC1 anticorps

Antigène: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCC1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ABCC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABCC1 Blocking Peptide, catalog no. 33R-4941, is also available for use as a blocking control in assays to test for specificity of this ABCC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABCC1

Antigène: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Autre désignation: ABCC1 (ABCC1 Produits)

Synonymes: anticorps ABC29, anticorps ABCC, anticorps GS-X, anticorps MRP, anticorps MRP1, anticorps Abcc1a, anticorps Abcc1b, anticorps Mdrap, anticorps Mrp1, anticorps Avcc1a, anticorps Mrp, anticorps ABCC13, anticorps ATP binding cassette subfamily C member 1, anticorps ATP-binding cassette, sub-family C (CFTR/MRP), member 1, anticorps multidrug resistance-associated protein 1, anticorps ABCC1, anticorps Abcc1, anticorps LOC100152428, anticorps LOC100346553

Sujet: ABCC1 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates.

Poids moléculaire: 171 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome