CRTAP anticorps (N-Term)
-
- Antigène Voir toutes CRTAP Anticorps
- CRTAP (Cartilage Associated Protein (CRTAP))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CRTAP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CRTAP antibody was raised against the N terminal of CRTAP
- Purification
- Affinity purified
- Immunogène
- CRTAP antibody was raised using the N terminal of CRTAP corresponding to a region with amino acids RLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYF
- Top Product
- Discover our top product CRTAP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CRTAP Blocking Peptide, catalog no. 33R-8020, is also available for use as a blocking control in assays to test for specificity of this CRTAP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRTAP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CRTAP (Cartilage Associated Protein (CRTAP))
- Autre désignation
- CRTAP (CRTAP Produits)
- Synonymes
- anticorps zgc:85621, anticorps wu:fb47h01, anticorps CASP, anticorps LEPREL3, anticorps OI7, anticorps 5730529N23Rik, anticorps Leprel3, anticorps RGD1565180, anticorps cartilage associated protein, anticorps cartilage-associated protein, anticorps crtap, anticorps CRTAP, anticorps LOC5574430, anticorps CpipJ_CPIJ013810, anticorps Crtap
- Sujet
- The protein encoded by this gene is similar to the chicken and mouse CRTAP genes. The encoded protein is a scaffolding protein that may influence the activity of at least one member of the cytohesin/ARNO family in response to specific cellular stimuli.
- Poids moléculaire
- 44 kDa (MW of target protein)
-