TXNDC16 anticorps (N-Term)

N° du produit ABIN635558

Détail du produit anti-TXNDC16 anticorps

Antigène: TXNDC16 (Thioredoxin Domain Containing 16 (TXNDC16))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TXNDC16 est non-conjugé

Application: Western Blotting (WB)

Specificité: TXNDC16 antibody was raised against the N terminal of TXNDC16

Purification: Affinity purified

Immunogène: TXNDC16 antibody was raised using the N terminal of TXNDC16 corresponding to a region with amino acids EVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGKAGV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TXNDC16 Blocking Peptide, catalog no. 33R-2774, is also available for use as a blocking control in assays to test for specificity of this TXNDC16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TXNDC16

Antigène: TXNDC16 (Thioredoxin Domain Containing 16 (TXNDC16))

Autre désignation: TXNDC16 (TXNDC16 Produits)

Synonymes: anticorps ERp90, anticorps KIAA1344, anticorps 5730420B22Rik, anticorps C77647, anticorps RGD1306755, anticorps thioredoxin domain containing 16, anticorps TXNDC16, anticorps Txndc16

Sujet: TXNDC16 contains 1 thioredoxin domain. The exact function of TXNDC16 remains unknown.

Poids moléculaire: 93 kDa (MW of target protein)