FIBCD1 anticorps (C-Term)

N° du produit ABIN635560

Détail du produit anti-FIBCD1 anticorps

Antigène: FIBCD1 (Fibrinogen C Domain Containing 1 (FIBCD1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FIBCD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: FIBCD1 antibody was raised against the C terminal of FIBCD1

Purification: Affinity purified

Immunogène: FIBCD1 antibody was raised using the C terminal of FIBCD1 corresponding to a region with amino acids DGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FIBCD1 Blocking Peptide, catalog no. 33R-1972, is also available for use as a blocking control in assays to test for specificity of this FIBCD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FIBCD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FIBCD1

Antigène: FIBCD1 (Fibrinogen C Domain Containing 1 (FIBCD1))

Autre désignation: FIBCD1 (FIBCD1 Produits)

Synonymes: anticorps fibcd1, anticorps AI448887, anticorps RGD1309097, anticorps fibrinogen C domain containing 1, anticorps fibrinogen C domain containing 1 L homeolog, anticorps FIBCD1, anticorps fibcd1.L, anticorps Fibcd1

Sujet: FIBCD1 is a single-pass membrane protein. It contains 1 fibrinogen C-terminal domain. The exact function of FIBCD1 remains unknown.

Poids moléculaire: 51 kDa (MW of target protein)