FIBCD1 anticorps (C-Term)
-
- Antigène Voir toutes FIBCD1 Anticorps
- FIBCD1 (Fibrinogen C Domain Containing 1 (FIBCD1))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FIBCD1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FIBCD1 antibody was raised against the C terminal of FIBCD1
- Purification
- Affinity purified
- Immunogène
- FIBCD1 antibody was raised using the C terminal of FIBCD1 corresponding to a region with amino acids DGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWY
- Top Product
- Discover our top product FIBCD1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FIBCD1 Blocking Peptide, catalog no. 33R-1972, is also available for use as a blocking control in assays to test for specificity of this FIBCD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FIBCD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FIBCD1 (Fibrinogen C Domain Containing 1 (FIBCD1))
- Autre désignation
- FIBCD1 (FIBCD1 Produits)
- Synonymes
- anticorps fibcd1, anticorps AI448887, anticorps RGD1309097, anticorps fibrinogen C domain containing 1, anticorps fibrinogen C domain containing 1 L homeolog, anticorps FIBCD1, anticorps fibcd1.L, anticorps Fibcd1
- Sujet
- FIBCD1 is a single-pass membrane protein. It contains 1 fibrinogen C-terminal domain. The exact function of FIBCD1 remains unknown.
- Poids moléculaire
- 51 kDa (MW of target protein)
-