TMEM209 anticorps (N-Term)

N° du produit ABIN635561

Détail du produit anti-TMEM209 anticorps

Antigène: TMEM209 (Transmembrane Protein 209 (TMEM209))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM209 est non-conjugé

Application: Western Blotting (WB)

Specificité: FLJ14803 antibody was raised against the N terminal Of Flj14803

Purification: Affinity purified

Immunogène: FLJ14803 antibody was raised using the N terminal Of Flj14803 corresponding to a region with amino acids MMQGEAHPSASLIDRTIKMRKETEARKVVLAWGLLNVSMAGMIYTEMTGK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FLJ14803 Blocking Peptide, catalog no. 33R-6235, is also available for use as a blocking control in assays to test for specificity of this FLJ14803 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ14803 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM209

Antigène: TMEM209 (Transmembrane Protein 209 (TMEM209))

Autre désignation: FLJ14803 (TMEM209 Produits)

Synonymes: anticorps flj14803, anticorps fc20f10, anticorps wu:fc20f10, anticorps NET31, anticorps 2700094F01Rik, anticorps AI428435, anticorps RGD1309682, anticorps transmembrane protein 209, anticorps transmembrane protein 209 S homeolog, anticorps tmem209, anticorps TMEM209, anticorps Tmem209, anticorps tmem209.S

Sujet: The specific function of FLJ14803 is not yet known.

Poids moléculaire: 62 kDa (MW of target protein)