SUN2 anticorps
-
- Antigène Voir toutes SUN2 Anticorps
- SUN2 (Sad1 and UNC84 Domain Containing 2 (SUN2))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SUN2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- UNC84 B antibody was raised using a synthetic peptide corresponding to a region with amino acids CWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFG
- Top Product
- Discover our top product SUN2 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UNC84B Blocking Peptide, catalog no. 33R-1831, is also available for use as a blocking control in assays to test for specificity of this UNC84B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC80 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SUN2 (Sad1 and UNC84 Domain Containing 2 (SUN2))
- Autre désignation
- UNC84B (SUN2 Produits)
- Synonymes
- anticorps UNC84B, anticorps B230369L08Rik, anticorps C030011B15, anticorps Unc84b, anticorps RGD1563141, anticorps Sad1 and UNC84 domain containing 2, anticorps SUN2, anticorps Sun2
- Sujet
- UNC84B plays a role in mitotic spindle organization and biogenesis.
- Poids moléculaire
- 48 kDa (MW of target protein)
- Pathways
- Maintenance of Protein Location, SARS-CoV-2 Protein Interactome, Phosphorylation & l'infection par le SRAS-CoV-2
-