POMT2 anticorps (Middle Region)
-
- Antigène Voir toutes POMT2 Anticorps
- POMT2 (Protein-O-Mannosyltransferase 2 (POMT2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp POMT2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- POMT2 antibody was raised against the middle region of POMT2
- Purification
- Affinity purified
- Immunogène
- POMT2 antibody was raised using the middle region of POMT2 corresponding to a region with amino acids AIGYLHSHRHLYPEGIGARQQQVTTYLHKDYNNLWIIKKHNTNSDPLDPS
- Top Product
- Discover our top product POMT2 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
POMT2 Blocking Peptide, catalog no. 33R-1266, is also available for use as a blocking control in assays to test for specificity of this POMT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POMT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- POMT2 (Protein-O-Mannosyltransferase 2 (POMT2))
- Autre désignation
- POMT2 (POMT2 Produits)
- Synonymes
- anticorps CG12311, anticorps DPOMT2, anticorps DmPOMT2, anticorps Dmel\\CG12311, anticorps EG:34F3.7, anticorps POMT2, anticorps Pomt2, anticorps dPOMT2, anticorps im:7153045, anticorps zPOMT2, anticorps zgc:158749, anticorps LGMD2N, anticorps MDDGA2, anticorps MDDGB2, anticorps MDDGC2, anticorps A830009D15Rik, anticorps AW046274, anticorps twisted, anticorps protein O-mannosyltransferase 2, anticorps protein-O-mannosyltransferase 2, anticorps tw, anticorps POMT2, anticorps pomt2, anticorps Pomt2
- Sujet
- POMT2 is an integral membrane protein of the endoplasmic reticulum (ER) that shares significant sequence similarity with a family of protein O-mannosyltransferases of S. cerevisiae.
- Poids moléculaire
- 38 kDa (MW of target protein)
-