Sideroflexin 4 anticorps (C-Term)
-
- Antigène Voir toutes Sideroflexin 4 (SFXN4) Anticorps
- Sideroflexin 4 (SFXN4)
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Sideroflexin 4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Sideroflexin 4 antibody was raised against the C terminal of SFXN4
- Purification
- Affinity purified
- Immunogène
- Sideroflexin 4 antibody was raised using the C terminal of SFXN4 corresponding to a region with amino acids SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV
- Top Product
- Discover our top product SFXN4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Sideroflexin 4 Blocking Peptide, catalog no. 33R-8343, is also available for use as a blocking control in assays to test for specificity of this Sideroflexin 4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFXN4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Sideroflexin 4 (SFXN4)
- Autre désignation
- Sideroflexin 4 (SFXN4 Produits)
- Synonymes
- anticorps im:7151335, anticorps si:ch211-117n7.3, anticorps zgc:153199, anticorps BCRM1, anticorps sideroflexin 4, anticorps Sfxn4, anticorps SFXN4, anticorps sfxn4
- Sujet
- SFXN4 is a multi-pass membrane protein. It belongs to the sideroflexin family. SFXN4 is a potential iron transporter.
- Poids moléculaire
- 38 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-