PLP1 anticorps (Middle Region)

N° du produit ABIN635575

Détail du produit anti-PLP1 anticorps

Antigène: PLP1 (Proteolipid Protein 1 (PLP1))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PLP1 antibody was raised against the middle region of PLP1

Purification: Affinity purified

Immunogène: PLP1 antibody was raised using the middle region of PLP1 corresponding to a region with amino acids IYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLP1 Blocking Peptide, catalog no. 33R-4219, is also available for use as a blocking control in assays to test for specificity of this PLP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLP1

Antigène: PLP1 (Proteolipid Protein 1 (PLP1))

Autre désignation: PLP1 (PLP1 Produits)

Synonymes: anticorps GPM6C, anticorps HLD1, anticorps MMPL, anticorps PLP, anticorps PLP/DM20, anticorps PMD, anticorps SPG2, anticorps Plp, anticorps PLP1, anticorps plp1, anticorps DKFZp459O081, anticorps DKFZp459O113, anticorps DM20, anticorps jimpy, anticorps jp, anticorps msd, anticorps rsh, anticorps plp, anticorps hld1, anticorps mmpl, anticorps plp1a, anticorps pmd, anticorps spg2, anticorps DMalpha2c, anticorps wu:fc27f01, anticorps wu:fj36d03, anticorps wu:fj42d08, anticorps zgc:110499, anticorps PLP-B, anticorps plp1-a, anticorps plp1-b, anticorps plp1b, anticorps proteolipid protein 1, anticorps proteolipid protein (myelin) 1, anticorps myelin proteolipid protein, anticorps proteolipid protein 1 L homeolog, anticorps proteolipid protein 1a, anticorps proteolipid protein 1 S homeolog, anticorps PLP1, anticorps Plp1, anticorps plp1, anticorps Tsp_11640, anticorps plp, anticorps plp1.L, anticorps plp1a, anticorps plp1.S

Sujet: PLP1 is a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2.

Poids moléculaire: 30 kDa (MW of target protein)