C17orf78 anticorps (Middle Region)
-
- Antigène Tous les produits C17orf78
- C17orf78 (Chromosome 17 Open Reading Frame78 (C17orf78))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C17orf78 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C17 ORF78 antibody was raised against the middle region of C17 rf78
- Purification
- Affinity purified
- Immunogène
- C17 ORF78 antibody was raised using the middle region of C17 rf78 corresponding to a region with amino acids LGARKLCQCQWLWRWQKKGGQPPGTAESKPDSQPQKVGQDAANSSNPKKA
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C17ORF78 Blocking Peptide, catalog no. 33R-4963, is also available for use as a blocking control in assays to test for specificity of this C17ORF78 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF78 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C17orf78 (Chromosome 17 Open Reading Frame78 (C17orf78))
- Autre désignation
- C17ORF78 (C17orf78 Produits)
- Synonymes
- anticorps chromosome 17 open reading frame 78, anticorps C17orf78
- Sujet
- The exact function of the protein encoded by this gene is not known.
- Poids moléculaire
- 30 kDa (MW of target protein)
-