C17orf78 anticorps (Middle Region)

N° du produit ABIN635579

Détail du produit anti-C17orf78 anticorps

Antigène: C17orf78 (Chromosome 17 Open Reading Frame78 (C17orf78))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C17orf78 est non-conjugé

Application: Western Blotting (WB)

Specificité: C17 ORF78 antibody was raised against the middle region of C17 rf78

Purification: Affinity purified

Immunogène: C17 ORF78 antibody was raised using the middle region of C17 rf78 corresponding to a region with amino acids LGARKLCQCQWLWRWQKKGGQPPGTAESKPDSQPQKVGQDAANSSNPKKA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C17ORF78 Blocking Peptide, catalog no. 33R-4963, is also available for use as a blocking control in assays to test for specificity of this C17ORF78 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF78 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C17orf78

Antigène: C17orf78 (Chromosome 17 Open Reading Frame78 (C17orf78))

Autre désignation: C17ORF78 (C17orf78 Produits)

Synonymes: anticorps chromosome 17 open reading frame 78, anticorps C17orf78

Sujet: The exact function of the protein encoded by this gene is not known.

Poids moléculaire: 30 kDa (MW of target protein)