LRRC37A3 anticorps (Middle Region)
-
- Antigène Tous les produits LRRC37A3
- LRRC37A3 (Leucine Rich Repeat Containing 37, Member A3 (LRRC37A3))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LRRC37A3 est non-conjugé
- Application
- Western Blotting (WB)
- Specificité
- LRRC37 A3 antibody was raised against the middle region of LRRC37 3
- Purification
- Affinity purified
- Immunogène
- LRRC37 A3 antibody was raised using the middle region of LRRC37 3 corresponding to a region with amino acids NYTSTELIIEPEEPSDSSGINLSGFGSEQLDTNDESDVTSTLSYILPYFS
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LRRC37A3 Blocking Peptide, catalog no. 33R-6945, is also available for use as a blocking control in assays to test for specificity of this LRRC37A3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC30 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LRRC37A3 (Leucine Rich Repeat Containing 37, Member A3 (LRRC37A3))
- Autre désignation
- LRRC37A3 (LRRC37A3 Produits)
- Synonymes
- anticorps LRRC37A, anticorps Lrrc37a3, anticorps RGD1559753, anticorps leucine rich repeat containing 37 member A3, anticorps leucine rich repeat containing 37A, anticorps leucine-rich repeat-containing protein 37A2, anticorps leucine-rich repeat-containing protein 37A3, anticorps LRRC37A3, anticorps Lrrc37a, anticorps LOC454756, anticorps LOC714675
- Sujet
- The function of LRRC37A3 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 180 kDa (MW of target protein)
-