FADS1 anticorps (N-Term)
-
- Antigène Voir toutes FADS1 Anticorps
- FADS1 (Fatty Acid Desaturase 1 (FADS1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FADS1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FADS1 antibody was raised against the N terminal of FADS1
- Purification
- Affinity purified
- Immunogène
- FADS1 antibody was raised using the N terminal of FADS1 corresponding to a region with amino acids RHPGGSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPSF
- Top Product
- Discover our top product FADS1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FADS1 Blocking Peptide, catalog no. 33R-7954, is also available for use as a blocking control in assays to test for specificity of this FADS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FADS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FADS1 (Fatty Acid Desaturase 1 (FADS1))
- Autre désignation
- FADS1 (FADS1 Produits)
- Synonymes
- anticorps D5D, anticorps FADS6, anticorps FADSD5, anticorps LLCDL1, anticorps TU12, anticorps D5FAD, anticorps 0710001O03Rik, anticorps A930006B21Rik, anticorps AI317215, anticorps DSD, anticorps fatty acid desaturase 1, anticorps FADS1, anticorps LOC483793, anticorps Fads1
- Sujet
- FADS1 is a member of the fatty acid desaturase (FADS) family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs.
- Poids moléculaire
- 52 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha
-