TECR anticorps (Middle Region)
-
- Antigène Voir toutes TECR Anticorps
- TECR (Trans-2,3-Enoyl-CoA Reductase (TECR))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TECR est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GPSN2 antibody was raised against the middle region of GPSN2
- Purification
- Affinity purified
- Immunogène
- GPSN2 antibody was raised using the middle region of GPSN2 corresponding to a region with amino acids PFIYGHKYDFTSSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLR
- Top Product
- Discover our top product TECR Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GPSN2 Blocking Peptide, catalog no. 33R-7077, is also available for use as a blocking control in assays to test for specificity of this GPSN2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPSN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TECR (Trans-2,3-Enoyl-CoA Reductase (TECR))
- Autre désignation
- GPSN2 (TECR Produits)
- Synonymes
- anticorps GPSN2, anticorps MRT14, anticorps SC2, anticorps TER, anticorps 2410016D23Rik, anticorps A230102P12Rik, anticorps AI173355, anticorps D17Ertd178e, anticorps Gpsn2, anticorps cb250, anticorps gpsn2, anticorps mg:db03b10, anticorps sb:cb250, anticorps wu:fj63b12, anticorps glycoprotein, synaptic 2, anticorps trans-2,3-enoyl-CoA reductase, anticorps trans-2,3-enoyl-CoA reductase b, anticorps gpsn2, anticorps TECR, anticorps Tecr, anticorps tecrb
- Sujet
- Microsomal long and very long chain fatty acid elongation uses malonyl-CoA as the 2-carbon donor and consists of 4 sequential reactions. GPSN2 catalyzes the final step, reducing trans-2,3-enoyl-CoA to saturated acyl-CoA.
- Poids moléculaire
- 36 kDa (MW of target protein)
-