TECR anticorps (Middle Region)

N° du produit ABIN635589

Détail du produit anti-TECR anticorps

Antigène: TECR (Trans-2,3-Enoyl-CoA Reductase (TECR))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TECR est non-conjugé

Application: Western Blotting (WB)

Specificité: GPSN2 antibody was raised against the middle region of GPSN2

Purification: Affinity purified

Immunogène: GPSN2 antibody was raised using the middle region of GPSN2 corresponding to a region with amino acids PFIYGHKYDFTSSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GPSN2 Blocking Peptide, catalog no. 33R-7077, is also available for use as a blocking control in assays to test for specificity of this GPSN2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPSN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TECR

Antigène: TECR (Trans-2,3-Enoyl-CoA Reductase (TECR))

Autre désignation: GPSN2 (TECR Produits)

Sujet: Microsomal long and very long chain fatty acid elongation uses malonyl-CoA as the 2-carbon donor and consists of 4 sequential reactions. GPSN2 catalyzes the final step, reducing trans-2,3-enoyl-CoA to saturated acyl-CoA.

Poids moléculaire: 36 kDa (MW of target protein)