VSIG1 anticorps (N-Term)

N° du produit ABIN635590

Détail du produit anti-VSIG1 anticorps

Antigène: VSIG1 (V-Set and Immunoglobulin Domain Containing 1 (VSIG1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VSIG1 est non-conjugé

Application: Western Blotting (WB)

Specificité: VSIG1 antibody was raised against the N terminal of VSIG1

Purification: Affinity purified

Immunogène: VSIG1 antibody was raised using the N terminal of VSIG1 corresponding to a region with amino acids SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VSIG1 Blocking Peptide, catalog no. 33R-8544, is also available for use as a blocking control in assays to test for specificity of this VSIG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VSIG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VSIG1

Antigène: VSIG1 (V-Set and Immunoglobulin Domain Containing 1 (VSIG1))

Autre désignation: VSIG1 (VSIG1 Produits)

Synonymes: anticorps VSIG1, anticorps vsig1, anticorps CHT1, anticorps 1700062D20Rik, anticorps GPA34, anticorps dJ889N15.1, anticorps 4930405J24Rik, anticorps ctx, anticorps ctx-A, anticorps gpa34, anticorps V-set and immunoglobulin domain containing 1, anticorps V-set and immunoglobulin domain containing 1 L homeolog, anticorps VSIG1, anticorps vsig1, anticorps Vsig1, anticorps vsig1.L

Sujet: The function of VSIG1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 42 kDa (MW of target protein)