BTNL9 anticorps (N-Term)

N° du produit ABIN635592

Détail du produit anti-BTNL9 anticorps

Antigène: BTNL9 (Butyrophilin-Like 9 (BTNL9))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BTNL9 est non-conjugé

Application: Western Blotting (WB)

Specificité: BTNL9 antibody was raised against the N terminal of BTNL9

Purification: Affinity purified

Immunogène: BTNL9 antibody was raised using the N terminal of BTNL9 corresponding to a region with amino acids EIRWFRSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BTNL9 Blocking Peptide, catalog no. 33R-2485, is also available for use as a blocking control in assays to test for specificity of this BTNL9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTNL9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BTNL9

Antigène: BTNL9 (Butyrophilin-Like 9 (BTNL9))

Autre désignation: BTNL9 (BTNL9 Produits)

Synonymes: anticorps BTN3, anticorps VDLS1900, anticorps B430208I01, anticorps Btn3, anticorps D330012D11Rik, anticorps MGC157148, anticorps butyrophilin like 9, anticorps butyrophilin-like 9, anticorps butyrophilin-like protein 9, anticorps BTNL9, anticorps Btnl9, anticorps LOC100396974

Sujet: The specific function of BTNL9 is not yet known.

Poids moléculaire: 60 kDa (MW of target protein)